Thanks, Ed! It seems that line breaker character '\n' was part of
reasons that caussd trouble. After I delete all line breaker in peptide
seq, I can load the seq into AceDB (BTW, AceDB4.9).
Qunfeng
>Qunfeng Dong,
>>> Somebody must have asked this question before. I am sorry I have to ask this
>> because Surprisingly I can't find any document describing how to load protei
n
>> sequence into AceDB. Isn't the usage of Peptide the same as DNA? Please help
!
>>Yes, I think it is, it seems to work for me. But.....some points to note...
>>> ps.what's wrong with the following simple ace file?
>>> When I tried to load this file, xace hangs at
>> Item: 2 Q08062
>> Line: 4 (49%)
>> Pased: 2
>> OK: 2
>> Errors: 0
>>Sorry, this is a bug in acedb to do with the way the file IO package works, th
e
>last length it reports is the length where the last object _starts_, when the
>code runs out of stuff to read it does an implicit close and we lose the lengt
h
>of stuff parsed so far. If you have a long ace file you don't notice because
>rounding means that the % always looks like the whole file was parsed...sigh.
>(Don't you just hate implicit closes)
>>The effect is that when you parse a short ace file it looks like it wasn't all
>parsed correctly. In the below example when I look in the database, the data i
s
>all there.
>>One point to note...in the below why do put the length as "40" when it is "82"
?
>>> ------------------------------------------------------
>> Protein : Q08062
>> Title "Malate dehydrogenase, cytoplasmic."
>> Peptide Q08062 40
>>>> Peptide : Q08062
>> MATQTAVTATTVPQGSPSVTGSASQGGILNSARQFFSLAAPKVEKDKEFSFRFLTSP
>> LRSKPAATVNADNFYMYACGSINMP
>> ------------------------------------------------------
>>cheers Ed
>>--
> ------------------------------------------------------------------------
>| Ed Griffiths, Acedb development, Informatics Group, |
>| Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, |
>| Hinxton, Cambridge CB10 1SA, UK |
>| |
>| email: edgrif at sanger.ac.uk Tel: +44-1223-494780 Fax: +44-1223-494919 |
> ------------------------------------------------------------------------
>
