Hello,
I'm trying to read protein sequences into AceDB 4.3 via ace files. I
_think_ I have the syntax right for the peptide data, but I get an error
message. For example, the entry
Protein SW:Q01705
Title "NTC1_MOUSE..."
DNA_homol MMNOTCHA "BLASTX" 14408 1 2531 79 7671
Database SWISSPROT Q01705
Peptide SW:Q01705
MPRLLTPLLCLTLLPARAARGLRCSQPSGTCLNGGRCEVASGTEACVASGSFVGQRCQDP
NPCLSTRCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLDKPCLANPCRNGGTCDLL
TLTEYKCRCSPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN
gives the error message
"Type of SW:Q01705 does not check in B object "SW:Q01705" "
Can anyone explain to me what is going on?
Thanks,
Simon Whitfield
simon at igbmc.u-strasbg.fr
--
IGBMC, BP 163, 67404 Illkirch Cedex, C.U. de Strasbourg, France.
Phone (+33) 03 88 65 34 33 Fax (+33) 03 88 65 32 46
